Lineage for d2q5aa1 (2q5a A:7-38)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1328562Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 1328563Superfamily b.72.1: WW domain [51045] (2 families) (S)
  5. 1328564Family b.72.1.1: WW domain [51046] (13 proteins)
  6. 1328600Protein Mitotic rotamase PIN1 [51047] (1 species)
  7. 1328601Species Human (Homo sapiens) [TaxId:9606] [51048] (35 PDB entries)
  8. 1328607Domain d2q5aa1: 2q5a A:7-38 [139882]
    Other proteins in same PDB: d2q5aa2
    complexed with 16p

Details for d2q5aa1

PDB Entry: 2q5a (more details), 1.5 Å

PDB Description: human Pin1 bound to L-PEPTIDE
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1

SCOPe Domain Sequences for d2q5aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q5aa1 b.72.1.1 (A:7-38) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]}
lppgwekamsrssgrvyyfnhitnasqwerps

SCOPe Domain Coordinates for d2q5aa1:

Click to download the PDB-style file with coordinates for d2q5aa1.
(The format of our PDB-style files is described here.)

Timeline for d2q5aa1: