![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.72: WW domain-like [51044] (3 superfamilies) core: 3-stranded meander beta-sheet |
![]() | Superfamily b.72.1: WW domain [51045] (2 families) ![]() |
![]() | Family b.72.1.1: WW domain [51046] (13 proteins) |
![]() | Protein Mitotic rotamase PIN1 [51047] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [51048] (35 PDB entries) |
![]() | Domain d2q5aa1: 2q5a A:7-38 [139882] Other proteins in same PDB: d2q5aa2 complexed with 16p |
PDB Entry: 2q5a (more details), 1.5 Å
SCOPe Domain Sequences for d2q5aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q5aa1 b.72.1.1 (A:7-38) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]} lppgwekamsrssgrvyyfnhitnasqwerps
Timeline for d2q5aa1: