SCOPe 2.08: Domain d2q5aa1: 2q5a A:7-38

Lineage for d2q5aa1 (2q5a A:7-38)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.72: WW domain-like [51044] (3 superfamilies)
   core: 3-stranded meander beta-sheet

4. Superfamily b.72.1: WW domain [51045] (2 families)

5. Family b.72.1.1: WW domain [51046] (13 proteins)

6. Protein Mitotic rotamase PIN1 [51047] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51048] (40 PDB entries)

8. Domain d2q5aa1: 2q5a A:7-38 [139882]
   Other proteins in same PDB: d2q5aa2
   complexed with 16p

Details for d2q5aa1

PDB Entry: 2q5a, 1.5 Å

PDB Description: human Pin1 bound to L-PEPTIDE

PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1

SCOPe Domain Sequences for d2q5aa1:

Sequence; same for both SEQRES and ATOM records:

>d2q5aa1 b.72.1.1 (A:7-38) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]}
lppgwekamsrssgrvyyfnhitnasqwerps

Timeline for d2q5aa1:

• d2q5aa1 first appeared in SCOP 1.73
  
• d2q5aa1 appears in SCOPe 2.07