Lineage for d2q5aa1 (2q5a A:7-38)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 676271Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 676272Superfamily b.72.1: WW domain [51045] (1 family) (S)
  5. 676273Family b.72.1.1: WW domain [51046] (10 proteins)
  6. 676290Protein Mitotic rotamase PIN1 [51047] (1 species)
  7. 676291Species Human (Homo sapiens) [TaxId:9606] [51048] (8 PDB entries)
  8. 676294Domain d2q5aa1: 2q5a A:7-38 [139882]
    Other proteins in same PDB: d2q5aa2
    complexed with 16p, cpi, nal, nh2; mutant

Details for d2q5aa1

PDB Entry: 2q5a (more details), 1.5 Å

PDB Description: human Pin1 bound to L-PEPTIDE
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1

SCOP Domain Sequences for d2q5aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q5aa1 b.72.1.1 (A:7-38) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]}
lppgwekamsrssgrvyyfnhitnasqwerps

SCOP Domain Coordinates for d2q5aa1:

Click to download the PDB-style file with coordinates for d2q5aa1.
(The format of our PDB-style files is described here.)

Timeline for d2q5aa1:

676294
d2q5aa1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2q5aa2