![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
![]() | Superfamily d.26.1: FKBP-like [54534] (4 families) ![]() |
![]() | Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins) |
![]() | Protein Mitotic rotamase PIN1, domain 2 [54547] (2 species) Domain 1 is a WW-domain |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54548] (33 PDB entries) |
![]() | Domain d2q5aa2: 2q5a A:51-163 [139883] Other proteins in same PDB: d2q5aa1 complexed with 16p |
PDB Entry: 2q5a (more details), 1.5 Å
SCOPe Domain Sequences for d2q5aa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q5aa2 d.26.1.1 (A:51-163) Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens) [TaxId: 9606]} eparvrcshllvkhsqsrrpsswrqekitrtkeealelingyiqkiksgeedfeslasqf sdcssakargdlgafsrgqmqkpfedasfalrtgemsgpvftdsgihiilrte
Timeline for d2q5aa2: