Lineage for d2q4na_ (2q4n A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2805542Family b.60.1.8: Rv2717c-like [141475] (3 proteins)
    bacterial and plant proteins with a fatty acid binding protein-like fold
    automatically mapped to Pfam PF08768
  6. 2805543Protein Hypothetical protein At1g79260 [141478] (1 species)
  7. 2805544Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [141479] (5 PDB entries)
    Uniprot O64527 14-166
  8. 2805547Domain d2q4na_: 2q4n A: [139871]
    automated match to d2a13a1

Details for d2q4na_

PDB Entry: 2q4n (more details), 1.32 Å

PDB Description: Ensemble refinement of the crystal structure of protein from Arabidopsis thaliana At1g79260
PDB Compounds: (A:) Uncharacterized protein At1g79260

SCOPe Domain Sequences for d2q4na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q4na_ b.60.1.8 (A:) Hypothetical protein At1g79260 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ppvhpfvaplsyllgtwrgqgegeyptipsfrygeeirfshsgkpviaytqktwklesga
pmhaesgyfrprpdgsievviaqstglvevqkgtynvdeqsiklksdlvgnaskvkeisr
efelvdgklsyvvrmstttnplqphlkaildkl

SCOPe Domain Coordinates for d2q4na_:

Click to download the PDB-style file with coordinates for d2q4na_.
(The format of our PDB-style files is described here.)

Timeline for d2q4na_: