Lineage for d2q4na1 (2q4n A:14-166)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 673645Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 673646Superfamily b.60.1: Lipocalins [50814] (8 families) (S)
    bind hydrophobic ligands in their interior
  5. 674108Family b.60.1.8: Rv2717c-like [141475] (2 proteins)
    bacterial and plant proteins with a fatty acid binding protein-like fold
  6. 674109Protein Hypothetical protein At1g79260 [141478] (1 species)
  7. 674110Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [141479] (2 PDB entries)
  8. 674112Domain d2q4na1: 2q4n A:14-166 [139871]
    automatically matched to 2A13 A:14-166

Details for d2q4na1

PDB Entry: 2q4n (more details), 1.32 Å

PDB Description: Ensemble refinement of the crystal structure of protein from Arabidopsis thaliana At1g79260
PDB Compounds: (A:) Uncharacterized protein At1g79260

SCOP Domain Sequences for d2q4na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q4na1 b.60.1.8 (A:14-166) Hypothetical protein At1g79260 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ppvhpfvaplsyllgtwrgqgegeyptipsfrygeeirfshsgkpviaytqktwklesga
pmhaesgyfrprpdgsievviaqstglvevqkgtynvdeqsiklksdlvgnaskvkeisr
efelvdgklsyvvrmstttnplqphlkaildkl

SCOP Domain Coordinates for d2q4na1:

Click to download the PDB-style file with coordinates for d2q4na1.
(The format of our PDB-style files is described here.)

Timeline for d2q4na1: