SCOP 1.73: Domain d2q4na1: 2q4n A:14-166

Lineage for d2q4na1 (2q4n A:14-166)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (8 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.8: Rv2717c-like [141475] (2 proteins)
   bacterial and plant proteins with a fatty acid binding protein-like fold

6. Protein Hypothetical protein At1g79260 [141478] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [141479] (2 PDB entries)

8. Domain d2q4na1: 2q4n A:14-166 [139871]
   automatically matched to 2A13 A:14-166

Details for d2q4na1

PDB Entry: 2q4n, 1.32 Å

PDB Description: Ensemble refinement of the crystal structure of protein from Arabidopsis thaliana At1g79260

PDB Compounds: (A:) Uncharacterized protein At1g79260

SCOP Domain Sequences for d2q4na1:

Sequence; same for both SEQRES and ATOM records:

>d2q4na1 b.60.1.8 (A:14-166) Hypothetical protein At1g79260 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ppvhpfvaplsyllgtwrgqgegeyptipsfrygeeirfshsgkpviaytqktwklesga
pmhaesgyfrprpdgsievviaqstglvevqkgtynvdeqsiklksdlvgnaskvkeisr
efelvdgklsyvvrmstttnplqphlkaildkl

Timeline for d2q4na1:

• d2q4na1 is new in SCOP 1.73
  
• d2q4na1 appears in SCOP 1.75
  
• d2q4na1 appears in the current release, SCOPe 2.08, called d2q4na_