PDB entry 2q4n

View 2q4n on RCSB PDB site
Description: Ensemble refinement of the crystal structure of protein from Arabidopsis thaliana At1g79260
Class: structural genomics, unknown function
Keywords: Ensemble Refinement, Refinement Methodology Development, AT1G79260, Structural Genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, CESG, UNKNOWN FUNCTION
Deposited on 2007-05-31, released 2007-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: 0.152
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein At1g79260
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At1g79260, YUP8H12R.14
    Database cross-references and differences (RAF-indexed):
    • Uniprot O64527 (Start-165)
      • modified residue (74)
      • modified residue (147)
    Domains in SCOPe 2.07: d2q4na_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q4nA (A:)
    snqlqqlqnpgesppvhpfvaplsyllgtwrgqgegeyptipsfrygeeirfshsgkpvi
    aytqktwklesgapmhaesgyfrprpdgsievviaqstglvevqkgtynvdeqsiklksd
    lvgnaskvkeisrefelvdgklsyvvrmstttnplqphlkaildkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q4nA (A:)
    ppvhpfvaplsyllgtwrgqgegeyptipsfrygeeirfshsgkpviaytqktwklesga
    pmhaesgyfrprpdgsievviaqstglvevqkgtynvdeqsiklksdlvgnaskvkeisr
    efelvdgklsyvvrmstttnplqphlkaildkl