SCOPe 2.07: Domain d2pnga_: 2png A:

Lineage for d2pnga_ (2png A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (4 families)

5. Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins)

6. Protein Type I fatty acid synthase ACP domain [89040] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [89041] (1 PDB entry)

8. Domain d2pnga_: 2png A: [139742]
   automated match to d2pnga1

Details for d2pnga_

PDB Entry: 2png

PDB Description: type i rat fatty acid synthase acyl carrier protein (acp) domain

PDB Compounds: (A:) Fatty acid synthase (EC 2.3.1.85)

SCOPe Domain Sequences for d2pnga_:

Sequence; same for both SEQRES and ATOM records:

>d2pnga_ a.28.1.1 (A:) Type I fatty acid synthase ACP domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gdgeaqrdlvkavahilgirdlaginldssladlgldslmgvevrqilerehdlvlpire
vrqltlrklqemsskagsdtelaapkskn

Timeline for d2pnga_:

• d2pnga_ first appeared in SCOP 1.73, called d2pnga1
  
• d2pnga_ appears in SCOPe 2.06
  
• d2pnga_ appears in the current release, SCOPe 2.08