Lineage for d2pnga_ (2png A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706109Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 2706110Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins)
  6. 2706184Protein Type I fatty acid synthase ACP domain [89040] (1 species)
  7. 2706185Species Norway rat (Rattus norvegicus) [TaxId:10116] [89041] (1 PDB entry)
  8. 2706186Domain d2pnga_: 2png A: [139742]
    automated match to d2pnga1

Details for d2pnga_

PDB Entry: 2png (more details)

PDB Description: type i rat fatty acid synthase acyl carrier protein (acp) domain
PDB Compounds: (A:) Fatty acid synthase (EC 2.3.1.85)

SCOPe Domain Sequences for d2pnga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pnga_ a.28.1.1 (A:) Type I fatty acid synthase ACP domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gdgeaqrdlvkavahilgirdlaginldssladlgldslmgvevrqilerehdlvlpire
vrqltlrklqemsskagsdtelaapkskn

SCOPe Domain Coordinates for d2pnga_:

Click to download the PDB-style file with coordinates for d2pnga_.
(The format of our PDB-style files is described here.)

Timeline for d2pnga_: