SCOP 1.73: Domain d2pnga1: 2png A:1-76

Lineage for d2pnga1 (2png A:1-76)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (3 families)

5. Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (5 proteins)

6. Protein Type I fatty acid synthase ACP domain [89040] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [89041] (2 PDB entries)

8. Domain d2pnga1: 2png A:1-76 [139742]
   automatically matched to d1n8la_

Details for d2pnga1

PDB Entry: 2png

PDB Description: type i rat fatty acid synthase acyl carrier protein (acp) domain

PDB Compounds: (A:) Fatty acid synthase (EC 2.3.1.85)

SCOP Domain Sequences for d2pnga1:

Sequence; same for both SEQRES and ATOM records:

>d2pnga1 a.28.1.1 (A:1-76) Type I fatty acid synthase ACP domain {Rat (Rattus norvegicus) [TaxId: 10116]}
gdgeaqrdlvkavahilgirdlaginldssladlgldslmgvevrqilerehdlvlpire
vrqltlrklqemsska

Timeline for d2pnga1:

• d2pnga1 is new in SCOP 1.73
  
• d2pnga1 appears in SCOP 1.75
  
• d2pnga1 appears in the current release, SCOPe 2.08, called d2pnga_