Lineage for d2pfqa1 (2pfq A:252-328)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715906Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2715907Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)
  6. 2716076Protein DNA polymerase lambda [101251] (1 species)
  7. 2716077Species Human (Homo sapiens) [TaxId:9606] [101252] (28 PDB entries)
  8. 2716108Domain d2pfqa1: 2pfq A:252-328 [139681]
    Other proteins in same PDB: d2pfqa2, d2pfqa3
    automated match to d1rzta1
    protein/DNA complex; complexed with dcp, mg, mn, na, ppv

Details for d2pfqa1

PDB Entry: 2pfq (more details), 2.1 Å

PDB Description: manganese promotes catalysis in a dna polymerase lambda-dna crystal
PDB Compounds: (A:) DNA polymerase lambda

SCOPe Domain Sequences for d2pfqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pfqa1 a.60.6.1 (A:252-328) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
hnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrmae
kiieilesghlrkldhi

SCOPe Domain Coordinates for d2pfqa1:

Click to download the PDB-style file with coordinates for d2pfqa1.
(The format of our PDB-style files is described here.)

Timeline for d2pfqa1: