![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.13: Arp2/3 complex 16 kDa subunit ARPC5 [69103] (1 family) ![]() automatically mapped to Pfam PF04699 |
![]() | Family a.118.13.1: Arp2/3 complex 16 kDa subunit ARPC5 [69104] (2 proteins) |
![]() | Protein automated matches [190348] (1 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [187175] (14 PDB entries) |
![]() | Domain d2p9kg_: 2p9k G: [139597] Other proteins in same PDB: d2p9ka1, d2p9ka2, d2p9kc_, d2p9kd1, d2p9kd2, d2p9ke_, d2p9kf_ automated match to d1k8kg_ complexed with atp, ca |
PDB Entry: 2p9k (more details), 2.59 Å
SCOPe Domain Sequences for d2p9kg_:
Sequence, based on SEQRES records: (download)
>d2p9kg_ a.118.13.1 (G:) automated matches {Cow (Bos taurus) [TaxId: 9913]} arfrkvdvdeydenkfvdeddggdgqagpdegevdsclrqgnmtaalqaalknppintks qavkdragsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqw hekalaaggvgsivrvltarktv
>d2p9kg_ a.118.13.1 (G:) automated matches {Cow (Bos taurus) [TaxId: 9913]} arfrkvdvdeydenkfvdeagpdegevdsclrqgnmtaalqaalknppintksqavkdra gsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqwhekalaa ggvgsivrvltarktv
Timeline for d2p9kg_: