Class a: All alpha proteins [46456] (290 folds) |
Fold a.148: Arp2/3 complex 21 kDa subunit ARPC3 [69059] (1 superfamily) 5 helices; one helix is surrounded by the others |
Superfamily a.148.1: Arp2/3 complex 21 kDa subunit ARPC3 [69060] (1 family) automatically mapped to Pfam PF04062 |
Family a.148.1.1: Arp2/3 complex 21 kDa subunit ARPC3 [69061] (2 proteins) |
Protein automated matches [190347] (1 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [187174] (12 PDB entries) |
Domain d2p9ke_: 2p9k E: [139595] Other proteins in same PDB: d2p9ka1, d2p9ka2, d2p9kc_, d2p9kd1, d2p9kd2, d2p9kf_, d2p9kg_ automated match to d1k8ke_ complexed with atp, ca |
PDB Entry: 2p9k (more details), 2.59 Å
SCOPe Domain Sequences for d2p9ke_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p9ke_ a.148.1.1 (E:) automated matches {Cow (Bos taurus) [TaxId: 9913]} payhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyeik neadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakpa nkqedevmraylqqlrqetglrlcekvfdpqndkpskwwtcfvkrqfmnkslsg
Timeline for d2p9ke_: