Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins) this domain interrupts the other domain which defines family |
Protein Phosphoglycerate dehydrogenase [51839] (2 species) has additional C-terminal domain of the ferredoxin fold |
Species Escherichia coli [TaxId:562] [51840] (7 PDB entries) |
Domain d2p9ea1: 2p9e A:108-295 [139562] Other proteins in same PDB: d2p9ea2, d2p9ea3, d2p9eb2, d2p9eb3, d2p9ec2, d2p9ec3, d2p9ed2, d2p9ed3 automatically matched to d1psda1 complexed with cit, nai, po4, so4; mutant |
PDB Entry: 2p9e (more details), 2.6 Å
SCOPe Domain Sequences for d2p9ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p9ea1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} ntrsvaelvigelllllrgvpeanakahrgvwnklaagsfeargkklgiigyghigtqlg ilaeslgmyvyfydienklplgnatqvqhlsdllnmsdvvslhvpenpstknmmgakeis lmkpgsllinasrgtvvdipaladalaskhlagaaidvfptepatnsdpftsplaefdnv lltphigg
Timeline for d2p9ea1: