Lineage for d1psda1 (1psd A:108-295)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 975118Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 975119Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 977277Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
    this domain interrupts the other domain which defines family
  6. 977348Protein Phosphoglycerate dehydrogenase [51839] (2 species)
    has additional C-terminal domain of the ferredoxin fold
  7. 977349Species Escherichia coli [TaxId:562] [51840] (7 PDB entries)
  8. 977358Domain d1psda1: 1psd A:108-295 [30097]
    Other proteins in same PDB: d1psda2, d1psda3, d1psdb2, d1psdb3
    complexed with nad, ser

Details for d1psda1

PDB Entry: 1psd (more details), 2.75 Å

PDB Description: the allosteric ligand site in the vmax-type cooperative enzyme phosphoglycerate dehydrogenase
PDB Compounds: (A:) d-3-phosphoglycerate dehydrogenase (phosphoglycerate dehydrogenase)

SCOPe Domain Sequences for d1psda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1psda1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]}
ntrsvaelvigelllllrgvpeanakahrgvwnklaagsfeargkklgiigyghigtqlg
ilaeslgmyvyfydienklplgnatqvqhlsdllnmsdvvslhvpenpstknmmgakeis
lmkpgsllinasrgtvvdipalcdalaskhlagaaidvfptepatnsdpftsplcefdnv
lltphigg

SCOPe Domain Coordinates for d1psda1:

Click to download the PDB-style file with coordinates for d1psda1.
(The format of our PDB-style files is described here.)

Timeline for d1psda1: