SCOPe 2.08: Domain d2p8zt1: 2p8z T:344-481

Lineage for d2p8zt1 (2p8z T:344-481)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (7 families)

5. Family b.43.3.1: Elongation factors [50448] (11 proteins)

6. Protein Elongation factor 2 (eEF-2), domain II [82118] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82119] (13 PDB entries)
   Uniprot P32324

8. Domain d2p8zt1: 2p8z T:344-481 [139551]
   Other proteins in same PDB: d2p8zt2, d2p8zt3, d2p8zt4, d2p8zt5
   automatically matched to d1n0ua1
   complexed with apr, gnp, so1

Details for d2p8zt1

PDB Entry: 2p8z, 8.9 Å

PDB Description: fitted structure of adpr-eef2 in the 80s:adpr-eef2:gdpnp:sordarin cryo-em reconstruction

PDB Compounds: (T:) Elongation factor 2

SCOPe Domain Sequences for d2p8zt1:

Sequence; same for both SEQRES and ATOM records:

>d2p8zt1 b.43.3.1 (T:344-481) Elongation factor 2 (eEF-2), domain II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
spvtaqayraeqlyegpaddanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfag
tvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfl
lktgtlttsetahnmkvm

Timeline for d2p8zt1:

• d2p8zt1 first appeared in SCOP 1.73
  
• d2p8zt1 appears in SCOPe 2.07