Lineage for d2p8zt5 (2p8z T:730-842)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953474Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) (S)
  5. 2953475Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (5 proteins)
    domain III structure is lacking some of the superfamily characters and is often disordered in crystals
  6. 2953476Protein Elongation factor 2 (eEF-2), C-terminal domain [419043] (2 species)
  7. 2953477Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [419528] (13 PDB entries)
    Uniprot P32324
  8. 2953499Domain d2p8zt5: 2p8z T:730-842 [139555]
    Other proteins in same PDB: d2p8zt1, d2p8zt2, d2p8zt3, d2p8zt4
    automatically matched to d1n0ua5
    complexed with apr, gnp, so1

    has additional insertions and/or extensions that are not grouped together

Details for d2p8zt5

PDB Entry: 2p8z (more details), 8.9 Å

PDB Description: fitted structure of adpr-eef2 in the 80s:adpr-eef2:gdpnp:sordarin cryo-em reconstruction
PDB Compounds: (T:) Elongation factor 2

SCOPe Domain Sequences for d2p8zt5:

Sequence, based on SEQRES records: (download)

>d2p8zt5 d.58.11.1 (T:730-842) Elongation factor 2 (eEF-2), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelrqatg
gqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl

Sequence, based on observed residues (ATOM records): (download)

>d2p8zt5 d.58.11.1 (T:730-842) Elongation factor 2 (eEF-2), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lveiqcpeqavggiysvlnkkrgqvvseeqtplftvkaylpvnesfgftgelrqatggqa
fpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl

SCOPe Domain Coordinates for d2p8zt5:

Click to download the PDB-style file with coordinates for d2p8zt5.
(The format of our PDB-style files is described here.)

Timeline for d2p8zt5: