![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) ![]() |
![]() | Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (5 proteins) domain III structure is lacking some of the superfamily characters and is often disordered in crystals |
![]() | Protein Elongation factor 2 (eEF-2), N-terminal domain [419042] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [419527] (13 PDB entries) Uniprot P32324 |
![]() | Domain d2p8zt4: 2p8z T:482-560 [139554] Other proteins in same PDB: d2p8zt1, d2p8zt2, d2p8zt3, d2p8zt5 automatically matched to d1n0ua4 complexed with apr, gnp, so1 |
PDB Entry: 2p8z (more details), 8.9 Å
SCOPe Domain Sequences for d2p8zt4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p8zt4 d.58.11.1 (T:482-560) Elongation factor 2 (eEF-2), N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kfsvspvvqvavevknandlpklveglkrlsksdpcvltymsesgehivagtgelhleic lqdlehdhagvplkisppv
Timeline for d2p8zt4:
![]() Domains from same chain: (mouse over for more information) d2p8zt1, d2p8zt2, d2p8zt3, d2p8zt5 |