![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
![]() | Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins) |
![]() | Protein Mn superoxide dismutase (MnSOD) [46618] (9 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [46619] (35 PDB entries) |
![]() | Domain d2p4kb1: 2p4k B:1-83 [139489] Other proteins in same PDB: d2p4ka2, d2p4kb2, d2p4kc2, d2p4kd2 automated match to d1pl4a1 complexed with mn |
PDB Entry: 2p4k (more details), 1.48 Å
SCOPe Domain Sequences for d2p4kb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p4kb1 a.2.11.1 (B:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]} khslpdlpydygalephinaqimqlhhskhhaanvnnlnvteekyqealakgdvtaqial qpalkfnggghinhsifwtnlsp
Timeline for d2p4kb1: