PDB entry 2p4k

View 2p4k on RCSB PDB site
Description: Contribution to Structure and Catalysis of Tyrosine 34 in Human Manganese Superoxide Dismutase
Class: oxidoreductase
Keywords: mnsod, manganese superoxide dismutase, y34n mutation, oxidoreductase
Deposited on 2007-03-12, released 2007-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-05-26, with a file datestamp of 2009-05-22.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: 0.16
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04179 (0-197)
      • engineered (33)
    Domains in SCOPe 2.07: d2p4ka1, d2p4ka2
  • Chain 'B':
    Compound: superoxide dismutase
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04179 (0-197)
      • engineered (33)
    Domains in SCOPe 2.07: d2p4kb1, d2p4kb2
  • Chain 'C':
    Compound: superoxide dismutase
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04179 (0-197)
      • engineered (33)
    Domains in SCOPe 2.07: d2p4kc1, d2p4kc2
  • Chain 'D':
    Compound: superoxide dismutase
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04179 (0-197)
      • engineered (33)
    Domains in SCOPe 2.07: d2p4kd1, d2p4kd2
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2p4kA (A:)
    khslpdlpydygalephinaqimqlhhskhhaanvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayylqyknvrpdylkai
    wnvinwenvterymackk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2p4kB (B:)
    khslpdlpydygalephinaqimqlhhskhhaanvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayylqyknvrpdylkai
    wnvinwenvterymackk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2p4kC (C:)
    khslpdlpydygalephinaqimqlhhskhhaanvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayylqyknvrpdylkai
    wnvinwenvterymackk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2p4kD (D:)
    khslpdlpydygalephinaqimqlhhskhhaanvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayylqyknvrpdylkai
    wnvinwenvterymackk