Lineage for d2p4kb1 (2p4k B:1-83)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 633305Fold a.2: Long alpha-hairpin [46556] (19 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 633495Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) (S)
  5. 633496Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)
  6. 633622Protein Mn superoxide dismutase (MnSOD) [46618] (7 species)
  7. 633675Species Human (Homo sapiens) [TaxId:9606] [46619] (23 PDB entries)
  8. 633677Domain d2p4kb1: 2p4k B:1-83 [139489]
    Other proteins in same PDB: d2p4ka2, d2p4kb2, d2p4kc2, d2p4kd2
    automatically matched to d1ap5a1
    complexed with mn; mutant

Details for d2p4kb1

PDB Entry: 2p4k (more details), 1.48 Å

PDB Description: Contribution to Structure and Catalysis of Tyrosine 34 in Human Manganese Superoxide Dismutase
PDB Compounds: (B:) superoxide dismutase

SCOP Domain Sequences for d2p4kb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p4kb1 a.2.11.1 (B:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
khslpdlpydygalephinaqimqlhhskhhaanvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlsp

SCOP Domain Coordinates for d2p4kb1:

Click to download the PDB-style file with coordinates for d2p4kb1.
(The format of our PDB-style files is described here.)

Timeline for d2p4kb1: