![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
![]() | Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) ![]() |
![]() | Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins) |
![]() | Protein Mn superoxide dismutase (MnSOD) [54721] (7 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54724] (23 PDB entries) |
![]() | Domain d2p4ka2: 2p4k A:84-198 [139488] Other proteins in same PDB: d2p4ka1, d2p4kb1, d2p4kc1, d2p4kd1 automatically matched to d1ap5a2 complexed with mn; mutant |
PDB Entry: 2p4k (more details), 1.48 Å
SCOP Domain Sequences for d2p4ka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p4ka2 d.44.1.1 (A:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]} ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk
Timeline for d2p4ka2: