SCOP 1.73: Domain d2p2lc1: 2p2l C:2-178

Lineage for d2p2lc1 (2p2l C:2-178)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rac [52595] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52596] (16 PDB entries)

8. Domain d2p2lc1: 2p2l C:2-178 [139467]
   automatically matched to d1hh4a_
   complexed with gdp, zn

Details for d2p2lc1

PDB Entry: 2p2l, 1.9 Å

PDB Description: rac1-gdp-zinc complex

PDB Compounds: (C:) ras-related c3 botulinum toxin substrate 1

SCOP Domain Sequences for d2p2lc1:

Sequence; same for both SEQRES and ATOM records:

>d2p2lc1 c.37.1.8 (C:2-178) Rac {Human (Homo sapiens) [TaxId: 9606]}
qaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtagq
edydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtkldlrd
dkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlc

Timeline for d2p2lc1:

• d2p2lc1 is new in SCOP 1.73
  
• d2p2lc1 appears in SCOP 1.75
  
• d2p2lc1 appears in the current release, SCOPe 2.08, called d2p2lc_