SCOPe 2.08: Domain d2p2lc_: 2p2l C:

Lineage for d2p2lc_ (2p2l C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rac [52595] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52596] (41 PDB entries)

8. Domain d2p2lc_: 2p2l C: [139467]
   automated match to d1hh4a_
   complexed with gdp, zn

Details for d2p2lc_

PDB Entry: 2p2l, 1.9 Å

PDB Description: rac1-gdp-zinc complex

PDB Compounds: (C:) ras-related c3 botulinum toxin substrate 1

SCOPe Domain Sequences for d2p2lc_:

Sequence; same for both SEQRES and ATOM records:

>d2p2lc_ c.37.1.8 (C:) Rac {Human (Homo sapiens) [TaxId: 9606]}
mqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
qedydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlcp

Timeline for d2p2lc_:

• d2p2lc_ first appeared in SCOP 1.73, called d2p2lc1
  
• d2p2lc_ appears in SCOPe 2.07