PDB entry 2p2l

View 2p2l on RCSB PDB site
Description: Rac1-GDP-Zinc Complex
Class: unknown function
Keywords: Rho Family GTPase, Zinc
Deposited on 2007-03-07, released 2007-05-01
The last revision prior to the SCOP 1.73 freeze date was dated 2007-05-01, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.177
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ras-related c3 botulinum toxin substrate 1
    Species: HOMO SAPIENS
    Gene: RAC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63000 (4-End)
      • conflict (81)
    Domains in SCOP 1.73: d2p2la1
  • Chain 'B':
    Compound: ras-related c3 botulinum toxin substrate 1
    Species: HOMO SAPIENS
    Gene: RAC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63000 (4-End)
      • conflict (81)
    Domains in SCOP 1.73: d2p2lb1
  • Chain 'C':
    Compound: ras-related c3 botulinum toxin substrate 1
    Species: HOMO SAPIENS
    Gene: RAC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63000 (4-End)
      • conflict (81)
    Domains in SCOP 1.73: d2p2lc1
  • Heterogens: ZN, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p2lA (A:)
    gsklmqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglw
    dtagqedydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtk
    ldlrddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairav
    lcpppvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p2lA (A:)
    mqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvgkpvnlglwdtagqed
    ydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtkldlrddk
    dtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlcp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2p2lB (B:)
    gsklmqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglw
    dtagqedydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtk
    ldlrddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairav
    lcpppvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p2lB (B:)
    mqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgpvnlglwdtagq
    edydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtkldlrd
    dkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlcp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2p2lC (C:)
    gsklmqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglw
    dtagqedydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtk
    ldlrddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairav
    lcpppvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p2lC (C:)
    mqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
    qedydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
    ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlcp