| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily) multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer |
Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families) ![]() basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat |
| Family a.204.1.3: AF0060-like [140794] (1 protein) consists of a single member with an orphan sequence; "circular permutation" of putative active site residues: the catalytic lysine resides in the N-terminal helix instead of the missing in this family C-terminal helix; probable biological unit is a tertramer, distinct from the MazG family tetramer |
| Protein Hypothetical protein AF0060 [140795] (1 species) Uniprot O30176 1-84 |
| Species Archaeoglobus fulgidus [TaxId:2234] [140796] (1 PDB entry) |
| Domain d2p06b1: 2p06 B:1-83 [139453] Other proteins in same PDB: d2p06b2 complexed with gol, mg |
PDB Entry: 2p06 (more details), 2.1 Å
SCOPe Domain Sequences for d2p06b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p06b1 a.204.1.3 (B:1-83) Hypothetical protein AF0060 {Archaeoglobus fulgidus [TaxId: 2234]}
mdyfrlaekflremhakymkrvsrpgntprpwfdfseerllsrlfeemdelreavekedw
enlrdelldvanfcmylwgklsv
Timeline for d2p06b1: