Lineage for d2p06a1 (2p06 A:1-84)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736411Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
    multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer
  4. 2736412Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families) (S)
    basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat
  5. 2736462Family a.204.1.3: AF0060-like [140794] (1 protein)
    consists of a single member with an orphan sequence; "circular permutation" of putative active site residues: the catalytic lysine resides in the N-terminal helix instead of the missing in this family C-terminal helix; probable biological unit is a tertramer, distinct from the MazG family tetramer
  6. 2736463Protein Hypothetical protein AF0060 [140795] (1 species)
    Uniprot O30176 1-84
  7. 2736464Species Archaeoglobus fulgidus [TaxId:2234] [140796] (1 PDB entry)
  8. 2736465Domain d2p06a1: 2p06 A:1-84 [139452]
    Other proteins in same PDB: d2p06b2
    complexed with gol, mg

Details for d2p06a1

PDB Entry: 2p06 (more details), 2.1 Å

PDB Description: Crystal structure of a predicted coding region AF_0060 from Archaeoglobus fulgidus DSM 4304
PDB Compounds: (A:) Hypothetical protein AF_0060

SCOPe Domain Sequences for d2p06a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p06a1 a.204.1.3 (A:1-84) Hypothetical protein AF0060 {Archaeoglobus fulgidus [TaxId: 2234]}
mdyfrlaekflremhakymkrvsrpgntprpwfdfseerllsrlfeemdelreavekedw
enlrdelldvanfcmylwgklsvk

SCOPe Domain Coordinates for d2p06a1:

Click to download the PDB-style file with coordinates for d2p06a1.
(The format of our PDB-style files is described here.)

Timeline for d2p06a1: