SCOPe 2.08: Domain d2p06a1: 2p06 A:1-84

Lineage for d2p06a1 (2p06 A:1-84)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
   multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer

4. Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families)
   basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat

5. Family a.204.1.3: AF0060-like [140794] (1 protein)
   consists of a single member with an orphan sequence; "circular permutation" of putative active site residues: the catalytic lysine resides in the N-terminal helix instead of the missing in this family C-terminal helix; probable biological unit is a tertramer, distinct from the MazG family tetramer

6. Protein Hypothetical protein AF0060 [140795] (1 species)
   Uniprot O30176 1-84

7. Species Archaeoglobus fulgidus [TaxId:2234] [140796] (1 PDB entry)

8. Domain d2p06a1: 2p06 A:1-84 [139452]
   Other proteins in same PDB: d2p06b2
   complexed with gol, mg

Details for d2p06a1

PDB Entry: 2p06, 2.1 Å

PDB Description: Crystal structure of a predicted coding region AF_0060 from Archaeoglobus fulgidus DSM 4304

PDB Compounds: (A:) Hypothetical protein AF_0060

SCOPe Domain Sequences for d2p06a1:

Sequence; same for both SEQRES and ATOM records:

>d2p06a1 a.204.1.3 (A:1-84) Hypothetical protein AF0060 {Archaeoglobus fulgidus [TaxId: 2234]}
mdyfrlaekflremhakymkrvsrpgntprpwfdfseerllsrlfeemdelreavekedw
enlrdelldvanfcmylwgklsvk

Timeline for d2p06a1:

• d2p06a1 first appeared in SCOP 1.73
  
• d2p06a1 appears in SCOPe 2.07