![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily) multihelical; interlocked heterodimer with F-box proteins |
![]() | Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) ![]() automatically mapped to Pfam PF01466 |
![]() | Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins) |
![]() | Protein Cyclin A/CDK2-associated p45, Skp1 [81378] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [81376] (9 PDB entries) |
![]() | Domain d2ovqa1: 2ovq A:1085-1159 [139384] Other proteins in same PDB: d2ovqa2, d2ovqb1, d2ovqb2 automatically matched to d1fqvb1 complexed with so4 |
PDB Entry: 2ovq (more details), 2.6 Å
SCOPe Domain Sequences for d2ovqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ovqa1 a.157.1.1 (A:1085-1159) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} ipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfniknd fteeeeaqvrkenqw
Timeline for d2ovqa1: