Class a: All alpha proteins [46456] (258 folds) |
Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily) multihelical; interlocked heterodimer with F-box proteins |
Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (1 family) |
Family a.157.1.1: Skp1 dimerisation domain-like [81380] (2 proteins) |
Protein Cyclin A/CDK2-associated p45, Skp1 [81378] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [81376] (8 PDB entries) |
Domain d2ovqa1: 2ovq A:1085-1159 [139384] Other proteins in same PDB: d2ovqa2 automatically matched to d1fqvb1 complexed with so4 |
PDB Entry: 2ovq (more details), 2.6 Å
SCOP Domain Sequences for d2ovqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ovqa1 a.157.1.1 (A:1085-1159) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} ipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfniknd fteeeeaqvrkenqw
Timeline for d2ovqa1: