Lineage for d2ovqa1 (2ovq A:1085-1159)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1507272Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
    multihelical; interlocked heterodimer with F-box proteins
  4. 1507273Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) (S)
    automatically mapped to Pfam PF01466
  5. 1507274Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins)
  6. 1507281Protein Cyclin A/CDK2-associated p45, Skp1 [81378] (1 species)
  7. 1507282Species Human (Homo sapiens) [TaxId:9606] [81376] (9 PDB entries)
  8. 1507286Domain d2ovqa1: 2ovq A:1085-1159 [139384]
    Other proteins in same PDB: d2ovqa2, d2ovqb1, d2ovqb2
    automatically matched to d1fqvb1
    complexed with so4

Details for d2ovqa1

PDB Entry: 2ovq (more details), 2.6 Å

PDB Description: structure of the skp1-fbw7-cyclinedegc complex
PDB Compounds: (A:) S-phase kinase-associated protein 1A

SCOPe Domain Sequences for d2ovqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ovqa1 a.157.1.1 (A:1085-1159) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]}
ipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfniknd
fteeeeaqvrkenqw

SCOPe Domain Coordinates for d2ovqa1:

Click to download the PDB-style file with coordinates for d2ovqa1.
(The format of our PDB-style files is described here.)

Timeline for d2ovqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ovqa2