Class b: All beta proteins [48724] (180 folds) |
Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) automatically mapped to Pfam PF01179 |
Family b.30.2.1: Amine oxidase catalytic domain [49999] (3 proteins) |
Protein Copper amine oxidase, domain 3 [50000] (4 species) |
Species Yeast (Hansenula polymorpha) [TaxId:4905] [50004] (4 PDB entries) |
Domain d2oqea1: 2oqe A:237-672 [139222] Other proteins in same PDB: d2oqea2, d2oqea3, d2oqeb2, d2oqeb3, d2oqec2, d2oqec3, d2oqed2, d2oqed3, d2oqee2, d2oqee3, d2oqef2, d2oqef3 automatically matched to d1a2va1 complexed with cu, gol, xe |
PDB Entry: 2oqe (more details), 1.6 Å
SCOPe Domain Sequences for d2oqea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oqea1 b.30.2.1 (A:237-672) Copper amine oxidase, domain 3 {Yeast (Hansenula polymorpha) [TaxId: 4905]} peappinvtqpegvsfkmtgnvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhri slsemivpygspefphqrkhaldigeygagymtnplslgcdckgvihyldahfsdragdp itvknavciheeddgllfkhsdfrdnfatslvtratklvvsqiftaanyeyclywvfmqd gairldirltgilntyilgddeeagpwgtrvypnvnahnhqhlfslridpridgdgnsaa acdaksspyplgspenmygnafysekttfktvkdsltnyesatgrswdifnpnkvnpysg kppsyklvstqcppllakegslvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvr gmrewigdgsenidntdilffhtfgithfpapedfplmpaepitlmlrprhfftenpgld iqpsyamttseakrav
Timeline for d2oqea1: