SCOPe 2.08: Domain d2oqee3: 2oqe E:116-236

Lineage for d2oqee3 (2oqe E:116-236)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.17: Cystatin-like [54402] (7 superfamilies)
Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
Superfamily d.17.2: Amine oxidase N-terminal region [54416] (2 families)
Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
duplication: contains two domains of this fold
Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
Species Yeast (Hansenula polymorpha) [TaxId:4905] [54422] (4 PDB entries)
Domain d2oqee3: 2oqe E:116-236 [139236]
Other proteins in same PDB: d2oqea1, d2oqeb1, d2oqec1, d2oqed1, d2oqee1, d2oqef1
automatically matched to d1a2va3
complexed with cu, gol, xe

Details for d2oqee3

PDB Entry: 2oqe (more details), 1.6 Å

PDB Description: crystal structure of hansenula polymorpha amine oxidase in complex with xe to 1.6 angstroms

PDB Compounds: (E:) Peroxisomal copper amine oxidase

SCOPe Domain Sequences for d2oqee3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oqee3 d.17.2.1 (E:116-236) Copper amine oxidase, domains 1 and 2 {Yeast (Hansenula polymorpha) [TaxId: 4905]}
ltvedlcsteevirndpavieqcvlsgipanemhkvycdpwtigyderwgtgkrlqqalv
yyrsdeddsqyshpldfcpivdteekkvifidipnrrrkvskhkhanfypkhmiekvgam
r

SCOPe Domain Coordinates for d2oqee3:

Click to download the PDB-style file with coordinates for d2oqee3.
(The format of our PDB-style files is described here.)

Timeline for d2oqee3: