PDB entry 2oqe

View 2oqe on RCSB PDB site
Description: Crystal Structure of Hansenula polymorpha amine oxidase in complex with Xe to 1.6 Angstroms
Class: oxidoreductase
Keywords: protein-derived cofactor, TPQ, Xe, xenon complex, OXIDOREDUCTASE
Deposited on 2007-01-31, released 2007-04-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisomal copper amine oxidase
    Species: Pichia angusta [TaxId:4905]
    Gene: AMO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12807 (Start-659)
      • modified residue (392)
      • modified residue (621)
    Domains in SCOPe 2.08: d2oqea1, d2oqea2, d2oqea3
  • Chain 'B':
    Compound: Peroxisomal copper amine oxidase
    Species: Pichia angusta [TaxId:4905]
    Gene: AMO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12807 (Start-659)
      • modified residue (392)
      • modified residue (621)
    Domains in SCOPe 2.08: d2oqeb1, d2oqeb2, d2oqeb3
  • Chain 'C':
    Compound: Peroxisomal copper amine oxidase
    Species: Pichia angusta [TaxId:4905]
    Gene: AMO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12807 (Start-659)
      • modified residue (392)
    Domains in SCOPe 2.08: d2oqec1, d2oqec2, d2oqec3
  • Chain 'D':
    Compound: Peroxisomal copper amine oxidase
    Species: Pichia angusta [TaxId:4905]
    Gene: AMO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12807 (Start-659)
      • modified residue (392)
    Domains in SCOPe 2.08: d2oqed1, d2oqed2, d2oqed3
  • Chain 'E':
    Compound: Peroxisomal copper amine oxidase
    Species: Pichia angusta [TaxId:4905]
    Gene: AMO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12807 (Start-659)
      • modified residue (392)
    Domains in SCOPe 2.08: d2oqee1, d2oqee2, d2oqee3
  • Chain 'F':
    Compound: Peroxisomal copper amine oxidase
    Species: Pichia angusta [TaxId:4905]
    Gene: AMO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12807 (Start-659)
      • modified residue (392)
    Domains in SCOPe 2.08: d2oqef1, d2oqef2, d2oqef3
  • Heterogens: CU, XE, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2oqeA (A:)
    aasaaparpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqgg
    plpprlayyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndp
    avieqcvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldf
    cpivdteekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsf
    kmtgnvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpygspefph
    qrkhaldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgl
    lfkhsdfrdnfatslvtratklvvsqiftaanyeyclywvfmqdgairldirltgilnty
    ilgddeeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspen
    mygnafysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppll
    akegslvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidnt
    dilffhtfgithfpapedfplmpaepitlmlrprhfftenpgldiqpsyamttseakrav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oqeA (A:)
    aparpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggplpp
    rlayyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndpavie
    qcvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldfcpiv
    dteekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsfkmtg
    nvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpygspefphqrkh
    aldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgllfkh
    sdfrdnfatslvtratklvvsqiftaanyeyclywvfmqdgairldirltgilntyilgd
    deeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspenmygn
    afysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppllakeg
    slvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidntdilf
    fhtfgithfpapedfplmpaepitlmlrprhfftenpgldiqpsyamttseakrav
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2oqeB (B:)
    aasaaparpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqgg
    plpprlayyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndp
    avieqcvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldf
    cpivdteekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsf
    kmtgnvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpygspefph
    qrkhaldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgl
    lfkhsdfrdnfatslvtratklvvsqiftaanyeyclywvfmqdgairldirltgilnty
    ilgddeeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspen
    mygnafysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppll
    akegslvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidnt
    dilffhtfgithfpapedfplmpaepitlmlrprhfftenpgldiqpsyamttseakrav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oqeB (B:)
    aaparpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggplp
    prlayyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndpavi
    eqcvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldfcpi
    vdteekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsfkmt
    gnvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpygspefphqrk
    haldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgllfk
    hsdfrdnfatslvtratklvvsqiftaanyeyclywvfmqdgairldirltgilntyilg
    ddeeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspenmyg
    nafysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppllake
    gslvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidntdil
    ffhtfgithfpapedfplmpaepitlmlrprhfftenpgldiqpsyamttseakrav
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2oqeC (C:)
    aasaaparpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqgg
    plpprlayyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndp
    avieqcvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldf
    cpivdteekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsf
    kmtgnvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpygspefph
    qrkhaldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgl
    lfkhsdfrdnfatslvtratklvvsqiftaanyeyclywvfmqdgairldirltgilnty
    ilgddeeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspen
    mygnafysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppll
    akegslvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidnt
    dilffhtfgithfpapedfplmpaepitlmlrprhfftenpgldiqpsyamttseakrav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oqeC (C:)
    aparpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggplpp
    rlayyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndpavie
    qcvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldfcpiv
    dteekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsfkmtg
    nvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpygspefphqrkh
    aldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgllfkh
    sdfrdnfatslvtratklvvsqiftaanyeyclywvfmqdgairldirltgilntyilgd
    deeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspenmygn
    afysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppllakeg
    slvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidntdilf
    fhtfgithfpapedfplmpaepitlmlrprhfftenpgldiqpsyamttseakrav
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2oqeD (D:)
    aasaaparpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqgg
    plpprlayyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndp
    avieqcvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldf
    cpivdteekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsf
    kmtgnvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpygspefph
    qrkhaldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgl
    lfkhsdfrdnfatslvtratklvvsqiftaanyeyclywvfmqdgairldirltgilnty
    ilgddeeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspen
    mygnafysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppll
    akegslvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidnt
    dilffhtfgithfpapedfplmpaepitlmlrprhfftenpgldiqpsyamttseakrav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oqeD (D:)
    aparpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggplpp
    rlayyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndpavie
    qcvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldfcpiv
    dteekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsfkmtg
    nvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpygspefphqrkh
    aldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgllfkh
    sdfrdnfatslvtratklvvsqiftaanyeyclywvfmqdgairldirltgilntyilgd
    deeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspenmygn
    afysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppllakeg
    slvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidntdilf
    fhtfgithfpapedfplmpaepitlmlrprhfftenpgldiqpsyamttseakrav
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2oqeE (E:)
    aasaaparpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqgg
    plpprlayyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndp
    avieqcvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldf
    cpivdteekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsf
    kmtgnvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpygspefph
    qrkhaldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgl
    lfkhsdfrdnfatslvtratklvvsqiftaanyeyclywvfmqdgairldirltgilnty
    ilgddeeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspen
    mygnafysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppll
    akegslvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidnt
    dilffhtfgithfpapedfplmpaepitlmlrprhfftenpgldiqpsyamttseakrav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oqeE (E:)
    aaparpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggplp
    prlayyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndpavi
    eqcvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldfcpi
    vdteekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsfkmt
    gnvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpygspefphqrk
    haldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgllfk
    hsdfrdnfatslvtratklvvsqiftaanyeyclywvfmqdgairldirltgilntyilg
    ddeeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspenmyg
    nafysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppllake
    gslvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidntdil
    ffhtfgithfpapedfplmpaepitlmlrprhfftenpgldiqpsyamttseakrav
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2oqeF (F:)
    aasaaparpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqgg
    plpprlayyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndp
    avieqcvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldf
    cpivdteekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsf
    kmtgnvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpygspefph
    qrkhaldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgl
    lfkhsdfrdnfatslvtratklvvsqiftaanyeyclywvfmqdgairldirltgilnty
    ilgddeeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspen
    mygnafysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppll
    akegslvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidnt
    dilffhtfgithfpapedfplmpaepitlmlrprhfftenpgldiqpsyamttseakrav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oqeF (F:)
    aparpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggplpp
    rlayyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndpavie
    qcvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldfcpiv
    dteekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsfkmtg
    nvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpygspefphqrkh
    aldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgllfkh
    sdfrdnfatslvtratklvvsqiftaanyeyclywvfmqdgairldirltgilntyilgd
    deeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspenmygn
    afysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppllakeg
    slvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidntdilf
    fhtfgithfpapedfplmpaepitlmlrprhfftenpgldiqpsyamttseakrav