Lineage for d2oqed1 (2oqe D:237-672)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2781474Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2781475Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
    automatically mapped to Pfam PF01179
  5. 2781476Family b.30.2.1: Amine oxidase catalytic domain [49999] (3 proteins)
  6. 2781477Protein Copper amine oxidase, domain 3 [50000] (4 species)
  7. 2781583Species Yeast (Hansenula polymorpha) [TaxId:4905] [50004] (4 PDB entries)
  8. 2781587Domain d2oqed1: 2oqe D:237-672 [139231]
    Other proteins in same PDB: d2oqea2, d2oqea3, d2oqeb2, d2oqeb3, d2oqec2, d2oqec3, d2oqed2, d2oqed3, d2oqee2, d2oqee3, d2oqef2, d2oqef3
    automatically matched to d1a2va1
    complexed with cu, gol, xe

Details for d2oqed1

PDB Entry: 2oqe (more details), 1.6 Å

PDB Description: crystal structure of hansenula polymorpha amine oxidase in complex with xe to 1.6 angstroms
PDB Compounds: (D:) Peroxisomal copper amine oxidase

SCOPe Domain Sequences for d2oqed1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oqed1 b.30.2.1 (D:237-672) Copper amine oxidase, domain 3 {Yeast (Hansenula polymorpha) [TaxId: 4905]}
peappinvtqpegvsfkmtgnvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhri
slsemivpygspefphqrkhaldigeygagymtnplslgcdckgvihyldahfsdragdp
itvknavciheeddgllfkhsdfrdnfatslvtratklvvsqiftaanyeyclywvfmqd
gairldirltgilntyilgddeeagpwgtrvypnvnahnhqhlfslridpridgdgnsaa
acdaksspyplgspenmygnafysekttfktvkdsltnyesatgrswdifnpnkvnpysg
kppsyklvstqcppllakegslvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvr
gmrewigdgsenidntdilffhtfgithfpapedfplmpaepitlmlrprhfftenpgld
iqpsyamttseakrav

SCOPe Domain Coordinates for d2oqed1:

Click to download the PDB-style file with coordinates for d2oqed1.
(The format of our PDB-style files is described here.)

Timeline for d2oqed1: