Lineage for d2omya1 (2omy A:417-495)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. Family b.1.18.15: Internalin Ig-like domain [81295] (3 proteins)
    truncated fold fused to an LRR domain
  6. Protein Internalin A [81973] (1 species)
  7. Species Listeria monocytogenes [TaxId:1639] [81974] (10 PDB entries)
  8. Domain d2omya1: 2omy A:417-495 [139151]
    Other proteins in same PDB: d2omya2, d2omya3, d2omyb2, d2omyb3, d2omyb4
    automated match to d2omza1
    complexed with ca, cl

Details for d2omya1

PDB Entry: 2omy (more details), 1.7000000000000002 Å

PDB Description: crystal structure of inla s192n/hec1 complex
PDB Compounds: (A:) Internalin-A

SCOPe Domain Sequences for d2omya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2omya1 b.1.18.15 (A:417-495) Internalin A {Listeria monocytogenes [TaxId: 1639]}
wtnapvnykanvsipntvknvtgaliapatisdggsytepditwnlpsytnevsytfsqp
vtigkgtttfsgtvtqplk

SCOPe Domain Coordinates for d2omya1 are not available.

Timeline for d2omya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2omya2, d2omya3
View in 3D
Domains from other chains:
(mouse over for more information)
d2omyb2, d2omyb3, d2omyb4