![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.15: Internalin Ig-like domain [81295] (3 proteins) truncated fold fused to an LRR domain |
![]() | Protein Internalin A [81973] (1 species) |
![]() | Species Listeria monocytogenes [TaxId:1639] [81974] (10 PDB entries) |
![]() | Domain d2omya1: 2omy A:417-495 [139151] Other proteins in same PDB: d2omya2, d2omya3, d2omyb2, d2omyb3, d2omyb4 automated match to d2omza1 complexed with ca, cl |
PDB Entry: 2omy (more details), 1.7 Å
SCOPe Domain Sequences for d2omya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2omya1 b.1.18.15 (A:417-495) Internalin A {Listeria monocytogenes [TaxId: 1639]} wtnapvnykanvsipntvknvtgaliapatisdggsytepditwnlpsytnevsytfsqp vtigkgtttfsgtvtqplk
Timeline for d2omya1: