SCOPe 2.08: Domain d2omya2: 2omy A:36-416

Lineage for d2omya2 (2omy A:36-416)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.1: Internalin LRR domain [52059] (4 proteins)
   capped at the N-end with a truncated EF-hand subdomain
   this is a repeat family; one repeat unit is 2omx A:261-239 found in domain

6. Protein Internalin A [82324] (1 species)

7. Species Listeria monocytogenes [TaxId:1639] [82325] (10 PDB entries)

8. Domain d2omya2: 2omy A:36-416 [139152]
   Other proteins in same PDB: d2omya1, d2omya3, d2omyb2, d2omyb3, d2omyb4
   automated match to d2omza2
   complexed with ca, cl
   applies to all domains of a family if the common domain is composed of a different number of small repeating units

Details for d2omya2

PDB Entry: 2omy, 1.7 Å

PDB Description: crystal structure of inla s192n/hec1 complex

PDB Compounds: (A:) Internalin-A

SCOPe Domain Sequences for d2omya2:

Sequence; same for both SEQRES and ATOM records:

>d2omya2 c.10.2.1 (A:36-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}
atitqdtpinqiftdtalaekmktvlgktnvtdtvsqtdldqvttlqadrlgiksidgve
ylnnltqinfsnnqltditplknltklvdilmnnnqiaditplanltnltgltlfnnqit
didplknltnlnrlelssntisdisalsgltslqqlnfgnqvtdlkplanlttlerldis
snkvsdisvlakltnlesliatnnqisditplgiltnldelslngnqlkdigtlasltnl
tdldlannqisnlaplsgltkltelklganqisnisplagltaltnlelnenqledispi
snlknltyltlyfnnisdispvssltklqrlffynnkvsdvsslanltninwlsaghnqi
sdltplanltritqlglndqa

Timeline for d2omya2:

• d2omya2 first appeared in SCOP 1.73
  
• d2omya2 appears in SCOPe 2.07