Lineage for d2omza1 (2omz A:417-495)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765887Family b.1.18.15: Internalin Ig-like domain [81295] (3 proteins)
    truncated fold fused to an LRR domain
  6. 2765888Protein Internalin A [81973] (1 species)
  7. 2765889Species Listeria monocytogenes [TaxId:1639] [81974] (10 PDB entries)
  8. 2765892Domain d2omza1: 2omz A:417-495 [148888]
    Other proteins in same PDB: d2omza2, d2omza3, d2omza4, d2omzb2, d2omzb3, d2omzb4
    automated match to d2omza1

Details for d2omza1

PDB Entry: 2omz (more details), 1.6 Å

PDB Description: crystal structure of inla y369a/hec1 complex
PDB Compounds: (A:) Internalin-A

SCOPe Domain Sequences for d2omza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2omza1 b.1.18.15 (A:417-495) Internalin A {Listeria monocytogenes [TaxId: 1639]}
wtnapvnykanvsipntvknvtgaliapatisdggsytepditwnlpsytnevsytfsqp
vtigkgtttfsgtvtqplk

SCOPe Domain Coordinates for d2omza1:

Click to download the PDB-style file with coordinates for d2omza1.
(The format of our PDB-style files is described here.)

Timeline for d2omza1: