Lineage for d2oadb1 (2oad B:79-209)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 915607Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 915608Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 915609Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 915887Protein Class pi GST [81347] (4 species)
  7. 915984Species Mouse (Mus musculus) [TaxId:10090] [47621] (9 PDB entries)
  8. 915998Domain d2oadb1: 2oad B:79-209 [138971]
    Other proteins in same PDB: d2oada2, d2oadb2
    automatically matched to d1baya1
    complexed with gtb; mutant

Details for d2oadb1

PDB Entry: 2oad (more details), 2.5 Å

PDB Description: structure of glutathione-s-transferase c169a mutant
PDB Compounds: (B:) Glutathione S-transferase P 1

SCOPe Domain Sequences for d2oadb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oadb1 a.45.1.1 (B:79-209) Class pi GST {Mouse (Mus musculus) [TaxId: 10090]}
ygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvkalpghlkpfetllsqnqg
gkafivgdqisfadynlldlllihqvlapgaldnfpllsayvarlsarpkikaflsspeh
vnrpingngkq

SCOPe Domain Coordinates for d2oadb1:

Click to download the PDB-style file with coordinates for d2oadb1.
(The format of our PDB-style files is described here.)

Timeline for d2oadb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2oadb2