Class a: All alpha proteins [46456] (258 folds) |
Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins) |
Protein Class pi GST [81347] (4 species) |
Species Mouse (Mus musculus) [TaxId:10090] [47621] (9 PDB entries) |
Domain d2oadb1: 2oad B:79-209 [138971] Other proteins in same PDB: d2oada2, d2oadb2 automatically matched to d1baya1 complexed with gtb; mutant |
PDB Entry: 2oad (more details), 2.5 Å
SCOP Domain Sequences for d2oadb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oadb1 a.45.1.1 (B:79-209) Class pi GST {Mouse (Mus musculus) [TaxId: 10090]} ygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvkalpghlkpfetllsqnqg gkafivgdqisfadynlldlllihqvlapgaldnfpllsayvarlsarpkikaflsspeh vnrpingngkq
Timeline for d2oadb1: