SCOP 1.73: Domain d2oadb1: 2oad B:79-209

Lineage for d2oadb1 (2oad B:79-209)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class pi GST [81347] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [47621] (9 PDB entries)

8. Domain d2oadb1: 2oad B:79-209 [138971]
   Other proteins in same PDB: d2oada2, d2oadb2
   automatically matched to d1baya1
   complexed with gtb; mutant

Details for d2oadb1

PDB Entry: 2oad, 2.5 Å

PDB Description: structure of glutathione-s-transferase c169a mutant

PDB Compounds: (B:) Glutathione S-transferase P 1

SCOP Domain Sequences for d2oadb1:

Sequence; same for both SEQRES and ATOM records:

>d2oadb1 a.45.1.1 (B:79-209) Class pi GST {Mouse (Mus musculus) [TaxId: 10090]}
ygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvkalpghlkpfetllsqnqg
gkafivgdqisfadynlldlllihqvlapgaldnfpllsayvarlsarpkikaflsspeh
vnrpingngkq

Timeline for d2oadb1:

• d2oadb1 is new in SCOP 1.73
  
• d2oadb1 appears in SCOP 1.75
  
• d2oadb1 appears in the current release, SCOPe 2.08