SCOPe 2.02: Domain d2oacb2: 2oac B:1-78

Lineage for d2oacb2 (2oac B:1-78)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)

6. Protein Class pi GST [81358] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [52866] (9 PDB entries)

8. Domain d2oacb2: 2oac B:1-78 [138968]
   Other proteins in same PDB: d2oaca1, d2oacb1
   automatically matched to d1glpa2
   complexed with gtb; mutant

Details for d2oacb2

PDB Entry: 2oac, 2.2 Å

PDB Description: mouse c14a glutathione-s-transferase mutant in complex with s-(p- nitrobenzyl) glutathione

PDB Compounds: (B:) Glutathione S-transferase P 1

SCOPe Domain Sequences for d2oacb2:

Sequence; same for both SEQRES and ATOM records:

>d2oacb2 c.47.1.5 (B:1-78) Class pi GST {Mouse (Mus musculus) [TaxId: 10090]}
ppytivyfpvrgraeamrmlladqgqswkeevvtidtwmqgllkptclygqlpkfedgdl
tlyqsnailrhlgrslgl

Timeline for d2oacb2:

• d2oacb2 first appeared in SCOP 1.73
  
• d2oacb2 appears in SCOPe 2.01
  
• d2oacb2 appears in SCOPe 2.03
  
• d2oacb2 appears in the current release, SCOPe 2.08