![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
![]() | Protein automated matches [190056] (195 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [225046] (14 PDB entries) |
![]() | Domain d2oacb2: 2oac B:1-78 [138968] Other proteins in same PDB: d2oaca1, d2oaca2, d2oacb1 automated match to d3hkrb1 complexed with gtb; mutant |
PDB Entry: 2oac (more details), 2.2 Å
SCOPe Domain Sequences for d2oacb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oacb2 c.47.1.0 (B:1-78) automated matches {Mouse (Mus musculus) [TaxId: 10090]} ppytivyfpvrgraeamrmlladqgqswkeevvtidtwmqgllkptclygqlpkfedgdl tlyqsnailrhlgrslgl
Timeline for d2oacb2: