Lineage for d2oacb2 (2oac B:1-78)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879989Species Mouse (Mus musculus) [TaxId:10090] [225046] (14 PDB entries)
  8. 2880004Domain d2oacb2: 2oac B:1-78 [138968]
    Other proteins in same PDB: d2oaca1, d2oaca2, d2oacb1
    automated match to d3hkrb1
    complexed with gtb; mutant

Details for d2oacb2

PDB Entry: 2oac (more details), 2.2 Å

PDB Description: mouse c14a glutathione-s-transferase mutant in complex with s-(p- nitrobenzyl) glutathione
PDB Compounds: (B:) Glutathione S-transferase P 1

SCOPe Domain Sequences for d2oacb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oacb2 c.47.1.0 (B:1-78) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ppytivyfpvrgraeamrmlladqgqswkeevvtidtwmqgllkptclygqlpkfedgdl
tlyqsnailrhlgrslgl

SCOPe Domain Coordinates for d2oacb2:

Click to download the PDB-style file with coordinates for d2oacb2.
(The format of our PDB-style files is described here.)

Timeline for d2oacb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2oacb1