SCOPe 2.08: Domain d2oaca2: 2oac A:1-78

Lineage for d2oaca2 (2oac A:1-78)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class pi GST [81358] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [52866] (9 PDB entries)

8. Domain d2oaca2: 2oac A:1-78 [138966]
   Other proteins in same PDB: d2oaca1, d2oacb1, d2oacb2
   automated match to d3hkrb1
   complexed with gtb; mutant

Details for d2oaca2

PDB Entry: 2oac, 2.2 Å

PDB Description: mouse c14a glutathione-s-transferase mutant in complex with s-(p- nitrobenzyl) glutathione

PDB Compounds: (A:) Glutathione S-transferase P 1

SCOPe Domain Sequences for d2oaca2:

Sequence; same for both SEQRES and ATOM records:

>d2oaca2 c.47.1.5 (A:1-78) Class pi GST {Mouse (Mus musculus) [TaxId: 10090]}
ppytivyfpvrgraeamrmlladqgqswkeevvtidtwmqgllkptclygqlpkfedgdl
tlyqsnailrhlgrslgl

Timeline for d2oaca2:

• d2oaca2 first appeared in SCOP 1.73
  
• d2oaca2 appears in SCOPe 2.07