Lineage for d2oaca2 (2oac A:1-78)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 991973Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 991974Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 992315Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 992593Protein Class pi GST [81358] (4 species)
  7. 992690Species Mouse (Mus musculus) [TaxId:10090] [52866] (9 PDB entries)
  8. 992701Domain d2oaca2: 2oac A:1-78 [138966]
    Other proteins in same PDB: d2oaca1, d2oacb1
    automatically matched to d1glpa2
    complexed with gtb; mutant

Details for d2oaca2

PDB Entry: 2oac (more details), 2.2 Å

PDB Description: mouse c14a glutathione-s-transferase mutant in complex with s-(p- nitrobenzyl) glutathione
PDB Compounds: (A:) Glutathione S-transferase P 1

SCOPe Domain Sequences for d2oaca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oaca2 c.47.1.5 (A:1-78) Class pi GST {Mouse (Mus musculus) [TaxId: 10090]}
ppytivyfpvrgraeamrmlladqgqswkeevvtidtwmqgllkptclygqlpkfedgdl
tlyqsnailrhlgrslgl

SCOPe Domain Coordinates for d2oaca2:

Click to download the PDB-style file with coordinates for d2oaca2.
(The format of our PDB-style files is described here.)

Timeline for d2oaca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2oaca1