| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins) |
| Protein Class pi GST [81347] (4 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [47621] (9 PDB entries) |
| Domain d2oaca1: 2oac A:79-209 [138965] Other proteins in same PDB: d2oaca2, d2oacb2 automatically matched to d1baya1 complexed with gtb; mutant |
PDB Entry: 2oac (more details), 2.2 Å
SCOPe Domain Sequences for d2oaca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oaca1 a.45.1.1 (A:79-209) Class pi GST {Mouse (Mus musculus) [TaxId: 10090]}
ygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvkalpghlkpfetllsqnqg
gkafivgdqisfadynlldlllihqvlapgcldnfpllsayvarlsarpkikaflsspeh
vnrpingngkq
Timeline for d2oaca1: