Lineage for d2o98b_ (2o98 B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)
  6. Protein automated matches [190238] (5 species)
    not a true protein
  7. 1501443Species Tobacco (Nicotiana tabacum) [TaxId:4097] [187162] (2 PDB entries)
  8. 1501446Domain d2o98b_: 2o98 B: [138951]
    automated match to d1o9ca_
    complexed with fsc, so4

Details for d2o98b_

PDB Entry: 2o98 (more details), 2.7 Å

PDB Description: structure of the 14-3-3 / h+-atpase plant complex
PDB Compounds: (B:) 14-3-3-like protein c

SCOPe Domain Sequences for d2o98b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o98b_ a.118.7.1 (B:) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
aptareenvymaklaeqaeryeemvefmekvsnslgseeltveernllsvayknvigarr
aswriissieqkeesrgneehvnsireyrskienelskicdgilklldaklipsaasgds
kvfylkmkgdyhrylaefktgaerkeaaestltaykaaqdiattelapthpirlglalnf
svfyyeilnspdracnlakqafdeaiaeldtlgeesykdstlimqllrdnltlwtsd

SCOPe Domain Coordinates for d2o98b_:

Click to download the PDB-style file with coordinates for d2o98b_.
(The format of our PDB-style files is described here.)

Timeline for d2o98b_: