Class a: All alpha proteins [46456] (290 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.7: 14-3-3 protein [48445] (1 family) automatically mapped to Pfam PF00244 |
Family a.118.7.1: 14-3-3 protein [48446] (5 proteins) |
Protein automated matches [190238] (11 species) not a true protein |
Species Tobacco (Nicotiana tabacum) [TaxId:4097] [187162] (2 PDB entries) |
Domain d2o98b_: 2o98 B: [138951] automated match to d1o9ca_ complexed with fsc, so4 |
PDB Entry: 2o98 (more details), 2.7 Å
SCOPe Domain Sequences for d2o98b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o98b_ a.118.7.1 (B:) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]} aptareenvymaklaeqaeryeemvefmekvsnslgseeltveernllsvayknvigarr aswriissieqkeesrgneehvnsireyrskienelskicdgilklldaklipsaasgds kvfylkmkgdyhrylaefktgaerkeaaestltaykaaqdiattelapthpirlglalnf svfyyeilnspdracnlakqafdeaiaeldtlgeesykdstlimqllrdnltlwtsd
Timeline for d2o98b_: