SCOPe 2.08: Domain d2o3zb2: 2o3z B:134-280

Lineage for d2o3zb2 (2o3z B:134-280)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.7: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89827] (2 proteins)
   duplication; there are two structural repeats of this fold; each repeat is elaborated with additional structures forming the active site

6. Protein UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89828] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [89829] (18 PDB entries)
   Uniprot O67648 3-270

8. Domain d2o3zb2: 2o3z B:134-280 [138906]
   automated match to d1xxea2
   complexed with ai7, cl, so4, zn

Details for d2o3zb2

PDB Entry: 2o3z, 2.25 Å

PDB Description: x-ray crystal structure of lpxc complexed with 3-heptyloxybenzoate

PDB Compounds: (B:) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase

SCOPe Domain Sequences for d2o3zb2:

Sequence; same for both SEQRES and ATOM records:

>d2o3zb2 d.14.1.7 (B:134-280) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC {Aquifex aeolicus [TaxId: 63363]}
epiivedegrlikaepsdtlevtyegefknflgrqkftfvegneeeivlartfafdweie
hikkvglgkggslkntlvlgkdkvynpeglryenepvrhkvfdligdlyllgspvkgkfy
sfrgghslnvklvkelakkqk

Timeline for d2o3zb2:

• d2o3zb2 first appeared in SCOP 1.73
  
• d2o3zb2 appears in SCOPe 2.07