PDB entry 2o3z

View 2o3z on RCSB PDB site
Description: X-ray crystal structure of LpxC complexed with 3-heptyloxybenzoate
Class: hydrolase
Keywords: Lipid A biosynthesis, Lipid synthesis, LpxC, 3-heptyloxybenzoate, HYDROLASE
Deposited on 2006-12-02, released 2007-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.197
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: lpxC, envA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67648
      • engineered (180)
    Domains in SCOPe 2.07: d2o3za1, d2o3za2
  • Chain 'B':
    Compound: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: lpxC, envA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67648
      • engineered (180)
    Domains in SCOPe 2.07: d2o3zb1, d2o3zb2
  • Heterogens: SO4, ZN, CL, AI7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o3zA (A:)
    mglektvkeklsfegvgihtgeyskliihpekegtgirffkngvyiparhefvvhtnhst
    dlgfkgqriktvehilsvlhlleitnvtievigneipildgsgwefyeairknilnqnre
    idyfvveepiivedegrlikaepsdtlevtyegefknflgrqkftfvegneeeivlartf
    afdweiehikkvglgkggslkntlvlgkdkvynpeglryenepvrhkvfdligdlyllgs
    pvkgkfysfrgghslnvklvkelakkqkltr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o3zA (A:)
    glektvkeklsfegvgihtgeyskliihpekegtgirffkngvyiparhefvvhtnhstd
    lgfkgqriktvehilsvlhlleitnvtievigneipildgsgwefyeairknilnqnrei
    dyfvveepiivedegrlikaepsdtlevtyegefknflgrqkftfvegneeeivlartfa
    fdweiehikkvglgkggslkntlvlgkdkvynpeglryenepvrhkvfdligdlyllgsp
    vkgkfysfrgghslnvklvkelakkqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2o3zB (B:)
    mglektvkeklsfegvgihtgeyskliihpekegtgirffkngvyiparhefvvhtnhst
    dlgfkgqriktvehilsvlhlleitnvtievigneipildgsgwefyeairknilnqnre
    idyfvveepiivedegrlikaepsdtlevtyegefknflgrqkftfvegneeeivlartf
    afdweiehikkvglgkggslkntlvlgkdkvynpeglryenepvrhkvfdligdlyllgs
    pvkgkfysfrgghslnvklvkelakkqkltr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o3zB (B:)
    glektvkeklsfegvgihtgeyskliihpekegtgirffkngvyiparhefvvhtnhstd
    lgfkgqriktvehilsvlhlleitnvtievigneipildgsgwefyeairknilnqnrei
    dyfvveepiivedegrlikaepsdtlevtyegefknflgrqkftfvegneeeivlartfa
    fdweiehikkvglgkggslkntlvlgkdkvynpeglryenepvrhkvfdligdlyllgsp
    vkgkfysfrgghslnvklvkelakkqk