![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.18: Complement control module/SCR domain [57534] (1 superfamily) disulfide-rich all-beta fold |
![]() | Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) ![]() |
![]() | Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins) Pfam PF00084 |
![]() | Protein CD46 (membrane cofactor protein, MCP) [57541] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57542] (2 PDB entries) |
![]() | Domain d2o39c2: 2o39 C:63-126 [138899] Other proteins in same PDB: d2o39a1, d2o39b_ automated match to d1ckla2 complexed with ca |
PDB Entry: 2o39 (more details), 2.85 Å
SCOPe Domain Sequences for d2o39c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o39c2 g.18.1.1 (C:63-126) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]} etcpyirdplngqavpangtyefgyqmhficnegyyligeeilycelkgsvaiwsgkppi cekv
Timeline for d2o39c2:
![]() Domains from other chains: (mouse over for more information) d2o39a1, d2o39b_, d2o39d1, d2o39d2 |