Lineage for d2o39c2 (2o39 C:63-126)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2638750Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 2638751Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) (S)
  5. 2638752Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
    Pfam PF00084
  6. 2638782Protein CD46 (membrane cofactor protein, MCP) [57541] (1 species)
  7. 2638783Species Human (Homo sapiens) [TaxId:9606] [57542] (2 PDB entries)
  8. 2638785Domain d2o39c2: 2o39 C:63-126 [138899]
    Other proteins in same PDB: d2o39a1, d2o39b_
    automated match to d1ckla2
    complexed with ca

Details for d2o39c2

PDB Entry: 2o39 (more details), 2.85 Å

PDB Description: human adenovirus type 11 knob in complex with domains scr1 and scr2 of cd46 (membrane cofactor protein, mcp)
PDB Compounds: (C:) Membrane cofactor protein

SCOPe Domain Sequences for d2o39c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o39c2 g.18.1.1 (C:63-126) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]}
etcpyirdplngqavpangtyefgyqmhficnegyyligeeilycelkgsvaiwsgkppi
cekv

SCOPe Domain Coordinates for d2o39c2:

Click to download the PDB-style file with coordinates for d2o39c2.
(The format of our PDB-style files is described here.)

Timeline for d2o39c2: